Skip to content

openvax/varcode

Folders and files

NameName
Last commit message
Last commit date

Latest commit

 

History

819 Commits
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 

Repository files navigation

Tests Coverage Status PyPI PyPI downloads

Varcode

Varcode is a library for working with genomic variant data in Python and predicting the impact of those variants on protein sequences.

Installation

You can install varcode using pip:

pip install varcode

You can install required reference genome data through PyEnsembl as follows:

# Downloads and installs the Ensembl releases (75 and 76)
pyensembl install --release 75 76

Example

import varcode

# Load TCGA MAF containing variants from their
variants = varcode.load_maf("tcga-ovarian-cancer-variants.maf")

print(variants)
### <VariantCollection from 'tcga-ovarian-cancer-variants.maf' with 6428 elements>
###  -- Variant(contig=1, start=69538, ref=G, alt=A, genome=GRCh37)
###  -- Variant(contig=1, start=881892, ref=T, alt=G, genome=GRCh37)
###  -- Variant(contig=1, start=3389714, ref=G, alt=A, genome=GRCh37)
###  -- Variant(contig=1, start=3624325, ref=G, alt=T, genome=GRCh37)
###  ...

# you can index into a VariantCollection and get back a Variant object
variant = variants[0]

# groupby_gene_name returns a dictionary whose keys are gene names
# and whose values are themselves VariantCollections
gene_groups = variants.groupby_gene_name()

# get variants which affect the TP53 gene
TP53_variants = gene_groups["TP53"]

# predict protein coding effect of every TP53 variant on
# each transcript of the TP53 gene
TP53_effects = TP53_variants.effects()

print(TP53_effects)
### <EffectCollection with 789 elements>
### -- PrematureStop(variant=chr17 g.7574003G>A, transcript_name=TP53-001, transcript_id=ENST00000269305, effect_description=p.R342*)
### -- ThreePrimeUTR(variant=chr17 g.7574003G>A, transcript_name=TP53-005, transcript_id=ENST00000420246)
### -- PrematureStop(variant=chr17 g.7574003G>A, transcript_name=TP53-002, transcript_id=ENST00000445888, effect_description=p.R342*)
### -- FrameShift(variant=chr17 g.7574030_7574030delG, transcript_name=TP53-001, transcript_id=ENST00000269305, effect_description=p.R333fs)
### ...

premature_stop_effect = TP53_effects[0]

print(str(premature_stop_effect.mutant_protein_sequence))
### 'MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELPPGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMF'

print(premature_stop_effect.aa_mutation_start_offset)
### 341

print(premature_stop_effect.transcript)
### Transcript(id=ENST00000269305, name=TP53-001, gene_name=TP53, biotype=protein_coding, location=17:7571720-7590856)

print(premature_stop_effect.gene.name)
### 'TP53'

If you are looking for a quick start guide, you can check out this iPython book that demonstrates simple use cases of Varcode.

Further reading

Feature guides live in docs/ and on the docs site:

See CHANGELOG.md for the release history.

Effect Types

Every concrete MutationEffect subclass that varcode may emit, grouped by biological context. Each row links to the class definition in varcode/effects/effect_classes.py via a browser text-fragment URL — links survive line-number drift as the source file evolves. Severity ordering across types is set by effect_priority(); the abstract bases — MutationEffect, TranscriptMutationEffect, CodingMutation, NonsilentCodingMutation, SpliceMechanismEffect, StructuralVariantEffect — define the shared interface; MutationEffect and NonsilentCodingMutation have dedicated entries in the API reference, and MultiOutcomeEffect is described in its own section below.

Effects that carry multiple possibilities

Several effects don't have a single deterministic protein-level outcome — splice-signal disruption can resolve as normal splicing, exon skipping, intron retention, or cryptic-site use; an exon-edge variant might be a routine coding effect or a splice disruption; a structural variant might affect multiple transcripts or have multiple plausible breakpoint resolutions; two or more cis variants on one transcript can compose into a joint mutant protein; and when phase is unknown between somatic and germline variants sharing a window, the somatic effect depends on which haplotype it landed on. Varcode wraps these as MultiOutcomeEffect instances. Every multi-outcome effect exposes the same surface:

  • .candidatestuple[EffectCandidate, ...]
  • Each EffectCandidate wraps an inner effect (.effect), a producer tag (.source, e.g. "varcode", "rna_evidence"), and free-form .evidence.
  • .effectstuple[MutationEffect, ...] — convenience that unwraps .candidates to inner effects when provenance isn't needed.
  • .most_likely_candidate / .most_likely_effect — producer-ordered top pick.
  • .highest_priority_candidate / .highest_priority_effect — most severe by effect_priority().

The MultiOutcomeEffect containers appear in the sub-tables below where they're emitted: SpliceOutcomeSet, ExonicSpliceSite, the StructuralVariantEffect sub-hierarchy, HaplotypeEffect, and PhaseCandidateSet.

Coding region — in-frame changes

Effect type Description
Substitution Coding mutation which causes simple substitution of one amino acid for another.
Insertion Coding mutation which causes insertion of amino acid(s).
Deletion Coding mutation which causes deletion of amino acid(s).
ComplexSubstitution Insertion and deletion of multiple amino acids.
Silent Mutation in coding sequence which does not change the amino acid sequence of the translated protein.
AlternateStartCodon Replace annotated start codon with alternative start codon (e.g. "ATG>CAG"); a Silent subclass since the initiator tRNA still loads Met.

Coding region — frame-disrupting / truncating

Effect type Description
FrameShift Out-of-frame insertion or deletion of nucleotides, causes novel protein sequence and often premature stop codon.
FrameShiftTruncation A frameshift which leads immediately to a stop codon (no novel amino acids created).
PrematureStop Insertion of stop codon, truncates protein.
StartLoss Mutation causes loss of start codon, likely result is that an alternate start codon will be used down-stream (possibly in a different frame).
StopLoss Loss of stop codon, causes extension of protein by translation of nucleotides from 3' UTR.

Splice-site disruption — where the signal was hit

DNA-level locations: these classes identify where a variant landed in the canonical splice window. They no longer appear as top-level effects — every splice-disrupting variant is wrapped in a SpliceOutcomeSet (varcode 6.0+), and these classes survive as the wrapper's disrupted_signal_class (a type) and as the splice_signal reference on each candidate mechanism (an instance). All four share the SpliceSite base.

Effect type Description
SpliceDonor Mutation at canonical donor GT (intronic +1/+2).
SpliceAcceptor Mutation at canonical acceptor AG (intronic -2/-1).
IntronicSpliceSite Other intronic positions in the splice window (+3..+6 donor, -3 acceptor; also +1/+2 or -1/-2 when the reference signal isn't canonical).
ExonicSpliceSite Last 3 bases of an exon (donor side) or first base of an exon (acceptor side); changes a codon and disrupts the splice signal. Carries alternate_effect (the coding consequence if splicing proceeds).

Splice mechanism — what the spliceosome does in response

These are the splice effects that carry a protein consequence. The protein-level outcome of a splice-signal hit is not deterministic from DNA alone, so varcode wraps every splice-signal disruption in a SpliceOutcomeSet (a MultiOutcomeEffect) carrying these mechanisms as candidates. Wrapping is always-on as of varcode 6.0 and lazy — only the cheap NormalSplicing candidate is built eagerly; the rest materialise on .candidates access. Each mechanism carries the originating disruption on its .splice_signal attribute (a SpliceSite instance), so you can always recover where the hit was off any mechanism. The set also records the disruption's class on .disrupted_signal_class (the SpliceSite subclass, e.g. SpliceDonor — a type, not an instance) for priority lookup.

Effect type Description
NormalSplicing Splice signal hit but splicing proceeds normally; protein consequence (if any) is whatever the underlying nucleotide change would produce.
ExonSkipping Affected exon excluded from the mature transcript; in-frame skip deletes amino acids, out-of-frame skip propagates a frameshift.
IntronRetention Intron stays in the mature transcript; translation usually hits a premature stop inside the retained intron.
CrypticDonor Disrupted canonical donor replaced by a nearby cryptic GT donor; exon extended or truncated.
CrypticAcceptor Disrupted canonical acceptor replaced by a nearby cryptic AG acceptor; exon extended or truncated.

Non-coding regions and unclassifiable contexts

Effect type Description
FivePrimeUTR Variant affects 5' untranslated region before start codon.
ThreePrimeUTR Variant affects 3' untranslated region after stop codon of mRNA.
Intronic Variant occurs between exons and is unlikely to affect splicing.
NoncodingTranscript Transcript doesn't code for a protein.
IncompleteTranscript Can't determine effect since transcript annotation is incomplete (often missing either the start or stop codon).
Intergenic Occurs outside of any annotated gene.
Intragenic Within the annotated boundaries of a gene but not in a region that's transcribed into pre-mRNA.
Failure Placeholder effect emitted when annotation failed but a non-empty effect list is required (raise_on_error=False).

Exon-level and structural-variant effects

ExonLoss is a plain Exonic effect. The structural-variant effects below (LargeDeletion through TranslocationToIntergenic) are MultiOutcomeEffects — their .candidates may include cryptic-exon outcomes, RNA-evidence-ranked alternatives, and so on. CrypticExonCandidate typically appears as a candidate inside those SV effects rather than standalone.

Effect type Description
ExonLoss Deletion of an entire exon, significantly disrupts protein.
LargeDeletion Structural deletion (<DEL> / <CN0>) removing one or more exons or an entire gene.
LargeDuplication Tandem duplication (<DUP>) overlapping exons; may yield copy-number increase or a fused reading frame.
Inversion Inversion (<INV>) flipping a stretch of a transcript; consequence depends on whether breakpoints fall in exons or introns.
GeneFusion Breakend (<BND>) whose mate lies in another protein-coding gene — the canonical fusion shape.
TranslocationToIntergenic Breakend whose mate lies in intergenic space; consequence depends on cryptic splice / ORF signals downstream.
CrypticExonCandidate An SV brings novel sequence into range of a transcript and motif scoring flags a plausible new splice acceptor / donor pair; attached as additional candidates on SV effects.

Multi-variant / phase-dependent effects

Both are MultiOutcomeEffects, emitted alongside per-variant effects (additive, not a replacement) when a phase resolver groups cis variants together or when phase between somatic and germline variants is unknown.

Effect type Description
HaplotypeEffect Joint effect of two or more cis variants on the same transcript; the combined mutant cDNA is built and translated as one unit.
PhaseCandidateSet Possibility set across phase hypotheses when a somatic variant and one or more germline variants share a window on a transcript and phase between them is unknown.

Coordinate System

Varcode currently uses a "base counted, one start" genomic coordinate system, to match the Ensembl annotation database. We are planning to switch over to "space counted, zero start" (interbase) coordinates, since that system allows for more uniform logic (no special cases for insertions). To learn more about genomic coordinate systems, read this blog post.

About

Library for manipulating genomic variants and predicting their effects

Resources

License

Code of conduct

Contributing

Stars

87 stars

Watchers

10 watching

Forks

Packages

 
 
 

Contributors