Skip to content
 
 

Repository files navigation

gLM2 Framework

gLM2 (Genomic Language Model 2) is a mixed-modality deep learning framework for extracting embeddings from biological sequences (amino acids and nucleotides). This framework allows you to extract high-dimensional embeddings from FASTA sequences using pre-trained gLM2 models from HuggingFace.

Overview

The gLM2 framework provides tools to:

  • Extract embeddings from FASTA sequences using pre-trained gLM2 models (gLM2_650M, gLM2_150M, etc.)
  • Process sequences in batches for efficient inference
  • Reduce embedding dimensionality using GPU-accelerated PCA (cuML)
  • Support both padded and variable-length embeddings
  • Handle mixed-modality sequences (amino acids and nucleotides)

Prerequisites

  • Python 3.10 or higher
  • uv package manager (install from https://github.com/astral-sh/uv)
  • CUDA-capable GPU (optional, but recommended for faster inference and PCA)
  • CUDA 12.x (for cuML GPU acceleration)

Environment Setup

1. Install uv (if not already installed)

# Using pip
pip install uv

2. Create Virtual Environment and Install Dependencies

Run the environment setup command:

uv sync
source .venv/bin/activate

This will:

  • Create a virtual environment (.venv/)
  • Install all required dependencies including:
    • PyTorch and Transformers (for model inference)
    • cuML and CuPy (for GPU-accelerated PCA)
    • BioPython (for FASTA file handling)
    • NumPy and other utilities

Note: The cuml-cu12 package is installed from the RAPIDS PyPI index, which requires CUDA 12.x. If you don't have CUDA or want CPU-only PCA, you may need to modify the dependencies.

3. Install Package in Editable Mode (Recommended)

For development and easier imports:

pip install -e .

Or with uv:

uv pip install -e .

Usage

Extract Embeddings from FASTA Sequences

The main module for extracting embeddings is retrieve_embeddings.

Basic Usage

python -m retrieve_embeddings.retrieve_embeddings \
    test_files/test.fasta \
    embeddings.npz

Full Command with All Options

python -m retrieve_embeddings.retrieve_embeddings \
    <path-to-input.fasta> \
    <path-to-output.npz> \
    --model-name tattabio/gLM2_650M \
    --batch-size 1 \
    --device cuda \
    --no-average

Command-Line Arguments

  • input_file (positional, required): Path to input FASTA file containing biological sequences
  • output_file (positional, required): Path to output .npz file where embeddings will be saved
  • --model-name (optional): HuggingFace model identifier (default: tattabio/gLM2_650M)
    • Available models: tattabio/gLM2_650M, tattabio/gLM2_150M
  • --batch-size (optional): Batch size for processing sequences (default: 1)
  • --device (optional): Device to run inference on - cuda, cpu, or auto (default: auto)
  • --no-average (optional): Keep per-token embeddings (default is mean pooled)
  • --no-validate (optional): Skip sequence validation (not recommended)

Output Format

The script outputs a compressed NumPy archive (.npz) file containing:

  • ids: Array of sequence IDs from the FASTA file
  • embeddings:
    • If mean pooled (default): Array with shape (num_sequences, hidden_dim)
    • If per-token (--no-average): Object array of variable-length embeddings

Example Commands

# Extract embeddings with default settings (mean pooled, GPU if available)
python -m retrieve_embeddings.retrieve_embeddings \
    test_files/test.fasta \
    embeddings.npz

# Extract per-token embeddings
python -m retrieve_embeddings.retrieve_embeddings \
    test_files/test.fasta \
    embeddings.npz \
    --no-average

# Use CPU and smaller batch size
python -m retrieve_embeddings.retrieve_embeddings \
    test_files/test.fasta \
    embeddings.npz \
    --device cpu \
    --batch-size 4

# Use a smaller model
python -m retrieve_embeddings.retrieve_embeddings \
    test_files/test.fasta \
    embeddings.npz \
    --model-name tattabio/gLM2_150M

Python API Usage

You can also use the functions programmatically:

from pathlib import Path
from retrieve_embeddings import process_fasta_and_save_embeddings

# Extract and save embeddings
process_fasta_and_save_embeddings(
    fasta_path=Path("test_files/test.fasta"),
    output_path=Path("embeddings.npz"),
    model_name="tattabio/gLM2_650M",
    batch_size=1,
    average_embeddings=True,
    device="cuda"
)

Reduce Embedding Dimensionality with PCA

After extracting embeddings, you can reduce their dimensionality using GPU-accelerated PCA:

Basic Usage

python -m pca.pca \
    --input-file embeddings.npz \
    --output-file embeddings_pca512.npz \
    --n-components 512

Full Command with All Options

python -m pca.pca \
    --input-file <path-to-input.npz> \
    --output-file <path-to-output.npz> \
    --n-components 512 \
    --random-state 42

Command-Line Arguments

  • --input-file (required): Path to input .npz file containing embeddings
  • --output-file (required): Path to output .npz file for reduced embeddings
  • --n-components (optional): Number of PCA components (default: 512)
  • --random-state (optional): Random seed for reproducibility (default: 42)

Supported Input Formats

The PCA module supports:

  • Padded embeddings: 3D array (batch_size, seq_len, dimension) - automatically flattened
  • Variable-length embeddings: Object array of variable-length embeddings - each flattened individually

Example

# Reduce to 256 dimensions
python -m pca.pca \
    --input-file embeddings.npz \
    --output-file embeddings_pca256.npz \
    --n-components 256

# Reduce with custom random seed
python -m pca.pca \
    --input-file embeddings.npz \
    --output-file embeddings_pca512.npz \
    --n-components 512 \
    --random-state 123

Python API for PCA

from pathlib import Path
from pca import reduce_embeddings_pca

# Reduce embedding dimensionality
reduce_embeddings_pca(
    input_file=Path("embeddings.npz"),
    output_file=Path("embeddings_pca512.npz"),
    n_components=512,
    random_state=42
)

Loading Embeddings

You can load the saved embeddings in Python:

import numpy as np
from pca import load_embeddings

# Load embeddings
embeddings, ids = load_embeddings("embeddings.npz")

print(f"Loaded {len(ids)} sequences")
print(f"Embeddings shape: {embeddings.shape}")

# Or load directly with numpy
data = np.load("embeddings.npz", allow_pickle=True)
sequence_ids = data["ids"]
embeddings = data["embeddings"]

Sequence Format

gLM2 supports mixed-modality sequences containing:

  • Amino acids (uppercase): A-Z (standard 20 plus ambiguous B, J, O, U, X, Z)
  • Nucleotides (lowercase): a, t, g, c, n (for ambiguous)
  • Special strand tokens: <+> and <-> to indicate positive/negative strand

Example Sequences

>seq1
<+>MALTKVEKRNRIKRRVRGKISGTQASPRLSVYKSNK<+>aattttttaaggaa<->MLGIDNIERVKPGGLEKGGRAFGFSAIVVVGNED

>seq2
<+>aatttaaaaaggaa

Project Structure

gLM2/
├── model/                    # gLM2 model architecture
│   ├── __init__.py
│   ├── configuration_glm2.py  # Model configuration
│   └── modeling_glm2.py      # Model implementation
├── retrieve_embeddings/       # Embedding extraction module
│   ├── __init__.py
│   ├── retrieve_embeddings.py # Main embedding extraction script
│   └── util.py                # Utility functions (FASTA reading, validation, saving)
├── pca/                       # PCA dimensionality reduction
│   ├── __init__.py
│   └── pca.py                 # PCA reduction script
├── test_files/                # Test data
│   └── test.fasta            # Example FASTA file
├── tests/                     # Unit tests
│   └── test_saving_loading.py
├── docs/                      # Documentation
│   └── images/
├── pyproject.toml             # Project dependencies and configuration
├── uv.lock                    # Locked dependency versions
└── README.md                  # This file

Testing

Run the test suite to verify your installation:

# Run all tests
pytest tests/

# Run specific test file
pytest tests/test_saving_loading.py -v

# Run with coverage
pytest tests/ --cov=retrieve_embeddings --cov=pca

Troubleshooting

Model Download Issues

The gLM2 models are automatically downloaded from HuggingFace on first use. If you encounter download issues:

  1. Check your internet connection
  2. Verify HuggingFace access (models are public, but you may need to accept terms)
  3. Try downloading manually from: https://huggingface.co/tattabio/gLM2_650M

CUDA/cuML Issues

If you encounter issues with cuML (GPU-accelerated PCA):

  1. CUDA not available: The framework will automatically fall back to CPU for model inference, but PCA requires cuML which needs CUDA 12.x
  2. cuML installation fails: This is expected - cuML must be installed via conda:
    conda install -c rapidsai -c conda-forge -c nvidia cuml
  3. CPU-only PCA: You can modify the code to use scikit-learn's PCA instead of cuML for CPU-only operation

Import Errors

If you encounter ModuleNotFoundError:

  1. Make sure the package is installed in editable mode:
    pip install -e .
  2. Verify the virtual environment is activated
  3. Check that pyproject.toml includes all necessary packages

Releases

Packages

Contributors

Languages